PDB entry 2bye

View 2bye on RCSB PDB site
Description: NMR solution structure of phospholipase c epsilon RA 1 domain
Class: lipase
Keywords: phospholipase c epsilon, ras association domain, ubiquitin superfold, lipase
Deposited on 2005-08-01, released 2006-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c, epsilon 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYE (0-0)
    • Uniprot Q5VWL5 (1-109)
    Domains in SCOPe 2.08: d2byea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2byeA (A:)
geerkclqthrvtvhgvpgpepftvftinggtkakqllqqiltneqdikpvttdyflmee
kyfiskeknecrkqpfqraigpeeeimqilsswfpeegymgrivlktqqe