Lineage for d2byea1 (2bye A:2-110)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502429Family d.15.1.5: Ras-binding domain, RBD [54263] (14 protein domains)
    contains Pfam PF00788 and Pfam PF02196
  6. 2502524Protein Phospholipase C-epsilon-1 [142966] (1 species)
    contains several Ras-binding domains; some are 'hidden' in the sequence
  7. 2502525Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries)
    Uniprot Q9P212 2006-2114! Uniprot Q9P212 2131-2246! Uniprot Q9P212 2134-2239
  8. 2502528Domain d2byea1: 2bye A:2-110 [129478]

Details for d2byea1

PDB Entry: 2bye (more details)

PDB Description: nmr solution structure of phospholipase c epsilon ra 1 domain
PDB Compounds: (A:) phospholipase c, epsilon 1

SCOPe Domain Sequences for d2byea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byea1 d.15.1.5 (A:2-110) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eerkclqthrvtvhgvpgpepftvftinggtkakqllqqiltneqdikpvttdyflmeek
yfiskeknecrkqpfqraigpeeeimqilsswfpeegymgrivlktqqe

SCOPe Domain Coordinates for d2byea1:

Click to download the PDB-style file with coordinates for d2byea1.
(The format of our PDB-style files is described here.)

Timeline for d2byea1: