PDB entry 2bv4

View 2bv4 on RCSB PDB site
Description: 1.0a structure of chromobacterium violaceum lectin in complex with alpha-methyl-mannoside
Class: lectin
Keywords: lectin, mannose, chromobacterium violaceum
Deposited on 2005-06-22, released 2006-05-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.107
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin cv-iil
    Species: Chromobacterium violaceum [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bv4a_
  • Chain 'B':
    Compound: lectin cv-iil
    Species: Chromobacterium violaceum [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bv4b_
  • Heterogens: CA, MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bv4A (A:)
aqqgvftlparinfgvtvlvnsaatqhveifvdnepraafsgvgtgdnnlgtkvinsgsg
nvrvqitangrqsdlvssqlvlanklnlavvgsedgtdmdyndsivilnwplg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bv4B (B:)
aqqgvftlparinfgvtvlvnsaatqhveifvdnepraafsgvgtgdnnlgtkvinsgsg
nvrvqitangrqsdlvssqlvlanklnlavvgsedgtdmdyndsivilnwplg