PDB entry 2buo

View 2buo on RCSB PDB site
Description: hiv-1 capsid c-terminal domain in complex with an inhibitor of particle assembly
Class: Viral protein/peptide
Keywords: hiv, capsid, inhibitor, assembly, polyprotein, complex (viral protein/peptide)
Deposited on 2005-06-17, released 2005-07-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.224
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2buoa1
  • Chain 'T':
    Compound: inhibitor of capsid assembly
    Database cross-references and differences (RAF-indexed):
    • PDB 2BUO (0-11)
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2buoA (A:)
sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
gpgatleemmtacqgvggpghkarvl

    Sequence, based on observed residues (ATOM records): (download) 
    >2buoA (A:)
ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
pgatleemmtacqgvggpghkarvl

  • Chain 'T':
    No sequence available.