Lineage for d2buoa1 (2buo A:148-219)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639818Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families) (S)
  5. 639819Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (4 proteins)
  6. 639825Protein HIV capsid protein, dimerisation domain [47359] (1 species)
  7. 639826Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (6 PDB entries)
  8. 639828Domain d2buoa1: 2buo A:148-219 [129224]
    automatically matched to d1a43__
    complexed with acy

Details for d2buoa1

PDB Entry: 2buo (more details), 1.7 Å

PDB Description: hiv-1 capsid c-terminal domain in complex with an inhibitor of particle assembly
PDB Compounds: (A:) hiv-1 capsid protein

SCOP Domain Sequences for d2buoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buoa1 a.28.3.1 (A:148-219) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq

SCOP Domain Coordinates for d2buoa1:

Click to download the PDB-style file with coordinates for d2buoa1.
(The format of our PDB-style files is described here.)

Timeline for d2buoa1: