PDB entry 2bt4

View 2bt4 on RCSB PDB site
Description: type II dehydroquinase inhibitor complex
Class: lyase
Keywords: shikimate pathway, dehydroquinate, lyase, amino-acid biosynthesis, aromatic amino acid biosynthesis
Deposited on 2005-05-26, released 2006-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4a_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4b_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4c_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4d_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4e_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4f_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4g_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4h_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4i_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4j_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4k_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt4l_
  • Heterogens: CA2, PO4, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bt4A (A:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4A (A:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bt4B (B:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4B (B:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bt4C (C:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4C (C:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bt4D (D:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4D (D:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bt4E (E:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4E (E:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bt4F (F:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4F (F:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bt4G (G:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4G (G:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bt4H (H:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4H (H:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bt4I (I:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4I (I:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bt4J (J:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4J (J:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bt4K (K:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4K (K:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bt4L (L:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt4L (L:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag