Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein automated matches [190071] (6 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [186791] (3 PDB entries) |
Domain d2bt4c_: 2bt4 C: [129142] automated match to d1d0ia_ complexed with ca2, gol, po4, trs |
PDB Entry: 2bt4 (more details), 1.7 Å
SCOPe Domain Sequences for d2bt4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt4c_ c.23.13.1 (C:) automated matches {Streptomyces coelicolor [TaxId: 1902]} rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy vsqradgvvagcgvqgyvfgveriaalag
Timeline for d2bt4c_: