PDB entry 2bl7
View 2bl7 on RCSB PDB site
Description: 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a
Class: immune system
Keywords: immune system, enterocin a, orf2 protein, immunity, bacterial protein
Deposited on
2005-03-02, released
2005-03-07
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2097
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: enterocine a immunity protein
Species: Enterococcus faecium [TaxId:1352]
Database cross-references and differences (RAF-indexed):
- Uniprot Q47785
- engineered mutation (30)
- engineered mutation (79)
Domains in SCOPe 2.02: d2bl7a1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2bl7A (A:)
mkknakqivhelyndisiskdpkysdilevmqkvylklekqkyeldpsplinrlvnylyf
taytnkirfteyqeelirnmseigrtaginglyradygdksqf
Sequence, based on observed residues (ATOM records): (download)
>2bl7A (A:)
knakqivhelyndisiskdpkysdilevmqkvylklekqkyeldpsplinrlvnylyfta
ytnkirfteyqeelirnmse