PDB entry 2bf9

View 2bf9 on RCSB PDB site
Description: anisotropic refinement of avian (turkey) pancreatic polypeptide at 0.99 angstroms resolution.
Class: hormone
Keywords: hormone, pancreatic hormone, turkey, pancreas, polypeptide, atomic resolution, anisotropic refinement
Deposited on 2004-12-06, released 2004-12-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.1371
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic hormone
    Species: MELEAGRIS GALLOPAVO [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2bf9a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bf9A (A:)
    gpsqptypgddapvedlirfyndlqqylnvvtrhrx