PDB entry 2bdp

View 2bdp on RCSB PDB site
Description: crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna
Deposited on 1997-11-17, released 1999-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.241
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bdpA (A:)
    aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak