PDB entry 2bch

View 2bch on RCSB PDB site
Description: A possible of Second calcium ion in interfacial binding: Atomic and Medium resolution crystal structures of the quadruple mutant of phospholipase A2
Class: hydrolase
Keywords: alpha helix, beta sheet, calcium ion and chloride ion, HYDROLASE
Deposited on 2005-10-19, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.12
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (52)
    • engineered (55)
    • engineered (119-120)
  Domains in SCOPe 2.07: d2bcha_
• Heterogens: CA, CL, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bchA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
  mnc