PDB entry 2bbi

View 2bbi on RCSB PDB site
Description: three-dimensional structure of soybean trypsin(slash)chymotrypsin bowman-birk inhibitor in solution
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1991-09-19, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsin/chymotrypsin bowman-birk inhibitor
  Species: Glycine max [TaxId:3847]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01055 (0-70)
  Domains in SCOPe 2.08: d2bbia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bbiA (A:)
  ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
  pckpseddken