Lineage for d2bbia_ (2bbi A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031913Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 3031914Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 3031915Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 3031932Species Soybean (Glycine max) [TaxId:3847] [57251] (5 PDB entries)
  8. 3031936Domain d2bbia_: 2bbi A: [44344]

Details for d2bbia_

PDB Entry: 2bbi (more details)

PDB Description: three-dimensional structure of soybean trypsin(slash)chymotrypsin bowman-birk inhibitor in solution
PDB Compounds: (A:) trypsin/chymotrypsin bowman-birk inhibitor

SCOPe Domain Sequences for d2bbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbia_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]}
ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
pckpseddken

SCOPe Domain Coordinates for d2bbia_:

Click to download the PDB-style file with coordinates for d2bbia_.
(The format of our PDB-style files is described here.)

Timeline for d2bbia_: