Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) |
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
Species Soybean (Glycine max) [TaxId:3847] [57251] (5 PDB entries) |
Domain d2bbia_: 2bbi A: [44344] |
PDB Entry: 2bbi (more details)
SCOPe Domain Sequences for d2bbia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bbia_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]} ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye pckpseddken
Timeline for d2bbia_: