PDB entry 2bba

View 2bba on RCSB PDB site
Description: Crystal Structure and Thermodynamic Characterization of the EphB4 Receptor in Complex with an ephrin-B2 Antagonist Peptide Reveals the Determinants for Receptor Specificity.
Class: signaling protein
Keywords: EphB4, tumorigenesis, angiogenesis, peptide mimetics, SIGNALING PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D
Deposited on 2005-10-17, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB4, HTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54760 (5-184)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2bbaa1, d2bbaa2
  • Chain 'P':
    Compound: Agonist peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2BBA (Start-14)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bbaA (A:)
hhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqah
wlrtgwvprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawm
enpyikvdtvaaehltrkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallslh
lfykk

  • Chain 'P':
    No sequence available.