Lineage for d2bbaa1 (2bba A:17-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774192Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 2774193Protein Ephrin type-B receptor 4 [158957] (1 species)
  7. 2774194Species Human (Homo sapiens) [TaxId:9606] [158958] (2 PDB entries)
    Uniprot P54760 17-196
  8. 2774195Domain d2bbaa1: 2bba A:17-196 [146133]
    Other proteins in same PDB: d2bbaa2
    automatically matched to 2HLE A:17-196
    complexed with so4

Details for d2bbaa1

PDB Entry: 2bba (more details), 1.65 Å

PDB Description: Crystal Structure and Thermodynamic Characterization of the EphB4 Receptor in Complex with an ephrin-B2 Antagonist Peptide Reveals the Determinants for Receptor Specificity.
PDB Compounds: (A:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2bbaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbaa1 b.18.1.4 (A:17-196) Ephrin type-B receptor 4 {Human (Homo sapiens) [TaxId: 9606]}
eetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtg
wvprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyi
kvdtvaaehltrkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk

SCOPe Domain Coordinates for d2bbaa1:

Click to download the PDB-style file with coordinates for d2bbaa1.
(The format of our PDB-style files is described here.)

Timeline for d2bbaa1: