PDB entry 2b9d

View 2b9d on RCSB PDB site
Description: Crystal Structure of HPV E7 CR3 domain
Class: transcription, viral protein
Keywords: Zinc Finger, Homodimer, transcription, viral protein
Deposited on 2005-10-11, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E7 protein
    Species: Human papillomavirus - 1 [TaxId:10583]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06465 (2-51)
      • cloning artifact (0-1)
      • engineered (34)
    Domains in SCOPe 2.07: d2b9da1, d2b9da2
  • Chain 'B':
    Compound: E7 protein
    Species: Human papillomavirus - 1 [TaxId:10583]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06465 (2-51)
      • cloning artifact (0-1)
      • engineered (34)
    Domains in SCOPe 2.07: d2b9db2, d2b9db3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9dA (A:)
    mkqpyavvascayceklvrltvladhsairqleemllrslnivcplctlqrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9dB (B:)
    mkqpyavvascayceklvrltvladhsairqleemllrslnivcplctlqrq