PDB entry 2b1q

View 2b1q on RCSB PDB site
Description: X-ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp.PCC6803 in complex with trehalose
Class: hydrolase
Keywords: phosphohydrolase, HAD superfamily, trehalose, cyanobacteria, HYDROLASE
Deposited on 2005-09-16, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein slr0953
    Species: Synechocystis sp. [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b1qa_
  • Heterogens: MG, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b1qA (A:)
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls