PDB entry 2axz

View 2axz on RCSB PDB site
Description: Crystal structure of PrgX/cCF10 complex
Class: transcription
Keywords: Repressor, pheromone, DNA binding, domain, TRANSCRIPTION
Deposited on 2005-09-06, released 2005-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
      • modified residue (296)
    Domains in SCOPe 2.06: d2axza1, d2axza2
  • Chain 'B':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
      • modified residue (296)
    Domains in SCOPe 2.06: d2axzb1, d2axzb2
  • Chain 'C':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.06: d2axzc1, d2axzc2
  • Chain 'D':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
      • modified residue (296)
    Domains in SCOPe 2.06: d2axzd1, d2axzd2
  • Chain 'E':
    Compound: LVTLVFV peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2AXZ (0-6)
  • Chain 'F':
    Compound: LVTLVFV peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2AXZ (0-6)
  • Chain 'H':
    Compound: LVTLVFV peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2AXZ (0-6)
  • Chain 'I':
    Compound: TPPKEVT(MSE) peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2AXZ (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axzA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axzA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2axzB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axzB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2axzC (C:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axzC (C:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2axzD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axzD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvai
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.