PDB entry 2awx

View 2awx on RCSB PDB site
Description: Synapse associated protein 97 PDZ2 domain variant C378S
Class: membrane protein
Keywords: membrane protein, synaptic signaling, trafficking protein
Deposited on 2005-09-02, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synapse associated protein 97
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62696
      • see remark 999 (3-4)
      • engineered mutation (64)
      • see remark 999 (88)
    Domains in SCOPe 2.07: d2awxa_
  • Chain 'B':
    Compound: Synapse associated protein 97
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62696
      • see remark 999 (3-4)
      • engineered mutation (64)
      • see remark 999 (88)
    Domains in SCOPe 2.07: d2awxb_
  • Heterogens: HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2awxA (A:)
mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdklla
vnsvsleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2awxA (A:)
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
svsleevtheeavtalkntsdfvylkvakpts

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2awxB (B:)
mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdklla
vnsvsleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2awxB (B:)
imeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavns
vsleevtheeavtalkntsdfvylkvakp