PDB entry 2at0

View 2at0 on RCSB PDB site
Description: 1.00 A Crystal Structure Of L133V Mutant of Nitrophorin 4 From Rhodnius Prolixus Complexed With Nitric Oxide at pH 5.6
Class: transport protein
Keywords: Lipocalin, beta barrel, ferrous heme, nitric oxide, TRANSPORT PROTEIN
Deposited on 2005-08-24, released 2006-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.14
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94734 (0-183)
      • engineered (132)
    Domains in SCOPe 2.02: d2at0x_
  • Heterogens: PO4, HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2at0X (X:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk