PDB entry 2asf

View 2asf on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein Rv2074 from Mycobacterium tuberculosis 1.6 A
Class: structural genomics, unknown function
Keywords: Rv2074, H37Rv, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2005-08-23, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv2074
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10682
      • modified residue (24)
    Domains in SCOPe 2.08: d2asfa1
  • Heterogens: NA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2asfA (A:)
    vamvntttrlsddalaflserhlamlttlradnsphvvavgftfdpkthiarvittggsq
    kavnadrsglavlsqvdgarwlslegraavnsdidavrdaelryaqryrtprpnprrvvi
    evqiervlgsadlldra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2asfA (A:)
    sddalaflserhlamlttlradnsphvvavgftfdpkthiarvittggsqkavnadrsgl
    avlsqvdgarwlslegraavnsdidavrdaelryaqryrtprpnprrvvievqiervlgs
    adlld