Lineage for d2asfa1 (2asf A:11-135)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794200Protein Hypothetical protein Rv2074 [141362] (1 species)
  7. 2794201Species Mycobacterium tuberculosis [TaxId:1773] [141363] (1 PDB entry)
    Uniprot Q10682 11-135
  8. 2794202Domain d2asfa1: 2asf A:11-135 [127253]
    complexed with cit, na

Details for d2asfa1

PDB Entry: 2asf (more details), 1.6 Å

PDB Description: Crystal structure of the conserved hypothetical protein Rv2074 from Mycobacterium tuberculosis 1.6 A
PDB Compounds: (A:) Hypothetical protein Rv2074

SCOPe Domain Sequences for d2asfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asfa1 b.45.1.1 (A:11-135) Hypothetical protein Rv2074 {Mycobacterium tuberculosis [TaxId: 1773]}
sddalaflserhlamlttlradnsphvvavgftfdpkthiarvittggsqkavnadrsgl
avlsqvdgarwlslegraavnsdidavrdaelryaqryrtprpnprrvvievqiervlgs
adlld

SCOPe Domain Coordinates for d2asfa1:

Click to download the PDB-style file with coordinates for d2asfa1.
(The format of our PDB-style files is described here.)

Timeline for d2asfa1: