![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Hypothetical protein Rv2074 [141362] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141363] (1 PDB entry) Uniprot Q10682 11-135 |
![]() | Domain d2asfa1: 2asf A:11-135 [127253] complexed with cit, na |
PDB Entry: 2asf (more details), 1.6 Å
SCOPe Domain Sequences for d2asfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asfa1 b.45.1.1 (A:11-135) Hypothetical protein Rv2074 {Mycobacterium tuberculosis [TaxId: 1773]} sddalaflserhlamlttlradnsphvvavgftfdpkthiarvittggsqkavnadrsgl avlsqvdgarwlslegraavnsdidavrdaelryaqryrtprpnprrvvievqiervlgs adlld
Timeline for d2asfa1: