PDB entry 2apq

View 2apq on RCSB PDB site
Description: Crystal Structure of an Active Site Mutant of Bovine Pancreatic Ribonuclease A (H119A-RNase A) with a 10-Glutamine expansion in the C-terminal hinge-loop.
Class: hydrolase
Keywords: An active site mutant of RNase A (H119A) with an amyloidogenic expansion in the C-terminal hinge-loop region(between residues 112 and 113)., HYDROLASE
Deposited on 2005-08-16, released 2005-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease
  Species: Bos taurus [TaxId:9913]
  Gene: RNASE1, RNS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (3-138)
    • insertion (114)
    • engineered (133)
  Domains in SCOPe 2.08: d2apqa_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2apqA (A:)
  amaketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqav
  csqknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivaceggqqqq
  qqqqqqgnpyvpvafdasv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2apqA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegyvpvafda
  sv