Lineage for d2apqa_ (2apq A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155703Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2155704Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2155705Family d.5.1.1: Ribonuclease A-like [54077] (9 protein domains)
  6. 2155814Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2155815Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)
  8. 2155895Domain d2apqa_: 2apq A: [162851]
    automated match to d1c9xa_
    complexed with po4; mutant

Details for d2apqa_

PDB Entry: 2apq (more details), 1.8 Å

PDB Description: Crystal Structure of an Active Site Mutant of Bovine Pancreatic Ribonuclease A (H119A-RNase A) with a 10-Glutamine expansion in the C-terminal hinge-loop.
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2apqa_:

Sequence, based on SEQRES records: (download)

>d2apqa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivaceggqqqqqqq
qqqgnpyvpvafdasv

Sequence, based on observed residues (ATOM records): (download)

>d2apqa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegyvpvafda
sv

SCOPe Domain Coordinates for d2apqa_:

Click to download the PDB-style file with coordinates for d2apqa_.
(The format of our PDB-style files is described here.)

Timeline for d2apqa_: