PDB entry 2acu

View 2acu on RCSB PDB site
Description: tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and the crystal structure of the y48h mutant enzyme
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1994-04-15, released 1994-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-314)
      • conflict (47)
    Domains in SCOPe 2.04: d2acua_
  • Heterogens: NAP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2acuA (A:)
    asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvhqnenevgvaiqe
    klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
    ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
    vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
    nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
    lsctshkdypfheef