PDB entry 2a3p

View 2a3p on RCSB PDB site
Description: Structure of Desulfovibrio desulfuricans G20 tetraheme cytochrome with bound molybdate
Class: electron transport
Keywords: Desulfovibrio, tetraheme cytochrome, cytochrome c3, ELECTRON TRANSPORT
Deposited on 2005-06-25, released 2006-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COG3005: Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit
    Species: Desulfovibrio desulfuricans subsp. desulfuricans str. [TaxId:207559]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a3pa_
  • Heterogens: HEM, MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a3pA (A:)
    mrkslfavmvlalvaafalpviaaeapadglkmentkmpvifnhsshssyqcadchhpvd
    gkenlakcatagchdvfdkkdksvhsyykiihdrkattvatcmschleaagsdkdlkkel
    tgckkskchp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a3pA (A:)
    aeapadglkmentkmpvifnhsshssyqcadchhpvdgkenlakcatagchdvfdkkdks
    vhsyykiihdrkattvatcmschleaagsdkdlkkeltgckkskchp