PDB entry 2a2s

View 2a2s on RCSB PDB site
Description: Crystal Structure of Human Glutathione Transferase in complex with S-nitrosoglutathione in the absence of reducing agent
Class: transferase
Keywords: transferase, detoxification, Nitric Oxide Carrier, S-nitrosoglutathione
Deposited on 2005-06-23, released 2006-06-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P
    Species: HOMO SAPIENS
    Gene: GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (1-209)
      • initiating methionine (0)
    Domains in SCOP 1.73: d2a2sa1, d2a2sa2
  • Chain 'B':
    Compound: Glutathione S-transferase P
    Species: HOMO SAPIENS
    Gene: GSTP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a2sb1, d2a2sb2
  • Heterogens: CA, CO3, MES, GSN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a2sA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a2sB (B:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2sB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq