SCOP 1.73: Domain d2a2sa1: 2a2s A:78-209

Lineage for d2a2sa1 (2a2s A:78-209)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (39 PDB entries)

8. Domain d2a2sa1: 2a2s A:78-209 [126062]
   Other proteins in same PDB: d2a2sa2, d2a2sb2
   automatically matched to d10gsa1
   complexed with ca, co3, gsn, mes

Details for d2a2sa1

PDB Entry: 2a2s, 1.7 Å

PDB Description: Crystal Structure of Human Glutathione Transferase in complex with S-nitrosoglutathione in the absence of reducing agent

PDB Compounds: (A:) Glutathione S-transferase P

SCOP Domain Sequences for d2a2sa1:

Sequence; same for both SEQRES and ATOM records:

>d2a2sa1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
lygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnq
ggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspe
yvnlpingngkq

Timeline for d2a2sa1:

• d2a2sa1 is new in SCOP 1.73
  
• d2a2sa1 appears in SCOP 1.75
  
• d2a2sa1 appears in the current release, SCOPe 2.08