PDB entry 2a2k

View 2a2k on RCSB PDB site
Description: Crystal Structure of an active site mutant, C473S, of Cdc25B Phosphatase Catalytic Domain
Class: hydrolase
Keywords: phosphatase, dual specificity, substrate trapping, active site mutant, hydrolase
Deposited on 2005-06-22, released 2006-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.182
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase inducer phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25B, CDC25HU2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30305 (1-174)
      • initiating methionine (0)
      • engineered (97)
    Domains in SCOPe 2.07: d2a2ka_
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2a2kA (A:)
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhsefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

    Sequence, based on observed residues (ATOM records): (download) 
    >2a2kA (A:)
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapkrvilifhsefssergprmcrfirerdravndyps
lyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw