PDB entry 2a1n

View 2a1n on RCSB PDB site
Description: Crystal structure of ferrous dioxygen complex of D251N cytochrome P450cam
Class: Oxidoreductase
Keywords: cytochrome P450, CYP, dioxygen complex, oxy, Oxidoreductase
Deposited on 2005-06-20, released 2005-07-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered (251)
      • engineered (334)
    Domains in SCOPe 2.02: d2a1na_
  • Chain 'B':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered (251)
      • engineered (334)
    Domains in SCOPe 2.02: d2a1nb_
  • Heterogens: K, HEM, OXY, CAM, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1nA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvgglntvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1nA (A:)
    nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
    gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
    enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
    dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
    gglntvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
    hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
    ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1nB (B:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvgglntvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1nB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    lntvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav