PDB entry 2a1i

View 2a1i on RCSB PDB site
Description: Crystal Structure of the Central Domain of Human ERCC1
Class: DNA binding protein
Keywords: ERCC1, XPF, NER, central domain, DNA repair, endonuclease, DNA BINDING PROTEIN
Deposited on 2005-06-20, released 2005-08-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA excision repair protein ERCC-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERCC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a1ia1
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1iA (A:)
    mgsshhhhhhsqdpaksnsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalfl
    slryhnlhpdyihgrlqslgknfalrvllvqvdvkdpqqalkelakmciladctlilaws
    peeagryletykayeqkpadllmekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1iA (A:)
    nsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihgrlq
    slgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletykayeqk
    padllmekl