PDB entry 1zuu

View 1zuu on RCSB PDB site
Description: Crystal structure of the yeast Bzz1 first SH3 domain at 0.97-A resolution
Class: unknown function
Keywords: SH3 domain, UNKNOWN FUNCTION
Deposited on 2005-06-01, released 2006-09-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.124
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BZZ1 protein
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38822 (3-57)
    • cloning artifact (2)
  Domains in SCOPe 2.02: d1zuua1
• Heterogens: MG, UNX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1zuuA (A:)
  gmenkvlyayvqkdddeititpgdkislvardtgsgwtkinndttgetglvpttyiri
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1zuuA (A:)
  enkvlyayvqkdddeititpgdkislvardtgsgwtkinndttgetglvpttyiri