PDB entry 1zoq

View 1zoq on RCSB PDB site
Description: IRF3-CBP complex
Class: transcription/transferase
Keywords: transcription regulation, transferase, transcription/transferase COMPLEX
Deposited on 2005-05-13, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interferon regulatory factor 3
  Species: Homo sapiens [TaxId:9606]
  Gene: IRF3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14653 (0-190)
• Chain 'B':
  Compound: Interferon regulatory factor 3
  Species: Homo sapiens [TaxId:9606]
  Gene: IRF3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14653 (0-190)
• Chain 'C':
  Compound: creb-binding protein
  Species: Homo sapiens [TaxId:9606]
  Gene: CREBBP, CBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92793 (0-46)
  Domains in SCOPe 2.07: d1zoqc_
• Chain 'D':
  Compound: creb-binding protein
  Species: Homo sapiens [TaxId:9606]
  Gene: CREBBP, CBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92793 (0-46)
  Domains in SCOPe 2.07: d1zoqd_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zoqC (C:)
  salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zoqD (D:)
  salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan