PDB entry 1zkz

View 1zkz on RCSB PDB site
Description: Crystal Structure of BMP9
Class: hormone/growth factor
Keywords: glycoprotein, growth factor, cytokine, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2005-05-04, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.233
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth/differentiation factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GDF2, BMP9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1zkzA (A:)
sagagshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtl
vhlkfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr

    Sequence, based on observed residues (ATOM records): (download) 
    >1zkzA (A:)
agshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtlvhl
kfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr