PDB entry 1zil

View 1zil on RCSB PDB site
Description: gcn4-leucine zipper core mutant asn16gln in the dimeric state
Deposited on 1996-10-30, released 1997-07-07
The last revision prior to the SCOP 1.59 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1zila_
  • Chain 'B':
    Domains in SCOP 1.59: d1zilb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zilA (A:)
    rmkqledkveellskqyhlenevarlkklv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zilB (B:)
    rmkqledkveellskqyhlenevarlkklv