PDB entry 1zij

View 1zij on RCSB PDB site
Description: gcn4-leucine zipper core mutant asn16aba in the trimeric state
Class: leucine zipper
Keywords: leucine zipper, amino-acid biosynthesis, transcription regulation, activator, DNA-binding, nuclear protein, coiled coil
Deposited on 1996-10-30, released 1997-07-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: -1.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control protein GCN4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-32)
      • modified residue (15)
    Domains in SCOPe 2.02: d1zija_
  • Chain 'B':
    Compound: General control protein GCN4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-32)
      • modified residue (15)
    Domains in SCOPe 2.02: d1zijb_
  • Chain 'C':
    Compound: General control protein GCN4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-32)
      • modified residue (15)
    Domains in SCOPe 2.02: d1zijc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zijA (A:)
    rmkqledkveellskayhlenevarlkklvger
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zijB (B:)
    rmkqledkveellskayhlenevarlkklvger
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zijC (C:)
    rmkqledkveellskayhlenevarlkklvger