PDB entry 1zfo

View 1zfo on RCSB PDB site
Description: amino-terminal lim-domain peptide of lasp-1, nmr
Deposited on 1996-05-06, released 1996-11-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1zfo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zfo_ (-)
    mnpncarcgkivyptekvncldkfwhkacf