PDB entry 1zcs

View 1zcs on RCSB PDB site
Description: Crystal Structure of the Arsenite-Inhibited and Reduced Form of Aldehyde Oxidoreductase from Desulfovibrio gigas
Class: oxidoreductase
Keywords: arsenite-inhibited, reduced molybdenum center, OXIDOREDUCTASE
Deposited on 2005-04-13, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.16
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde oxidoreductase
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zcsa5, d1zcsa6, d1zcsa7, d1zcsa8
  • Heterogens: CL, MG, PCD, AST, FES, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zcsA (A:)
    miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
    vtkmkrvadgaqittiegvgqpenlhplqkawvlhggaqcgfcspgfivsakglldtnad
    psredvrdwfqkhrnacrctgykplvdavmdaaavingkkpetdlefkmpadgriwgsky
    prptavakvtgtldygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvi
    thkdvkgknritglitfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekv
    kvdleelpaymsgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyv
    grqphmpiepdvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggt
    fgykfsptsealvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllam
    esdwlvdhgpysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqs
    mfaseclmdmlaeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaal
    ekaqkestathkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadig
    cvgtahealrpmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkace
    kpgggyytydelkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdva
    tgqttvdgmtlmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpf
    ikqipdkldivyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypek
    vlealka