Class a: All alpha proteins [46456] (290 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species) |
Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries) Uniprot Q46509 |
Domain d1zcsa6: 1zcs A:81-193 [303444] Other proteins in same PDB: d1zcsa5, d1zcsa7, d1zcsa8 automated match to d1vlba1 complexed with ast, cl, fes, ipa, mg, pcd |
PDB Entry: 1zcs (more details), 1.45 Å
SCOPe Domain Sequences for d1zcsa6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcsa6 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]} qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl
Timeline for d1zcsa6: