PDB entry 1zaw

View 1zaw on RCSB PDB site
Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form A
Class: structural protein
Keywords: ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk, thiostrepton loop of 23S rRNA, translation factor recruitment, GTPase stimulation, mechanism of translation, X-ray crystallography, rapid kinetics, cryo-electron microscopy, STRUCTURAL PROTEIN
Deposited on 2005-04-07, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l10
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29394 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (14)
      • modified residue (143)
    Domains in SCOPe 2.07: d1zawa1, d1zawa2
  • Chain 'U':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29396 (0-29)
      • modified residue (0)
    Domains in SCOPe 2.07: d1zawu1
  • Chain 'V':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29396 (0-29)
      • modified residue (0)
    Domains in SCOPe 2.07: d1zawv1
  • Chain 'W':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29396 (0-29)
      • modified residue (0)
    Domains in SCOPe 2.07: d1zaww1
  • Chain 'X':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29396 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1zawx1
  • Chain 'Y':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29396 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1zawy1
  • Chain 'Z':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zawz1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zawA (A:)
    vmltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkn
    tllnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfle
    gkkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekkse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zawA (A:)
    vmltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkn
    tllnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfle
    gkkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zawU (U:)
    mtideiieaiekltvselaelvkkledkfg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zawV (V:)
    mtideiieaiekltvselaelvkkledkfg
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zawW (W:)
    mtideiieaiekltvselaelvkkledkfg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1zawX (X:)
    mtideiieaiekltvselaelvkkledkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zawX (X:)
    mtideiieaiekltvselaelvkkledkf
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1zawY (Y:)
    mtideiieaiekltvselaelvkkledkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zawY (Y:)
    mtideiieaiekltvselaelvkkledkf
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1zawZ (Z:)
    mtideiieaiekltvselaelvkkledkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zawZ (Z:)
    tideiieaiekltvselaelvkkledk