PDB entry 1zae

View 1zae on RCSB PDB site
Description: Solution structure of the functional domain of phi29 replication organizer p16.7c
Class: DNA binding protein
Keywords: phi-29 replication, nonspecific DNA binding protein, helical dimer
Deposited on 2005-04-06, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: early protein gp16.7
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16517 (2-69)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1zaea2, d1zaea3
  • Chain 'B':
    Compound: early protein gp16.7
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16517 (2-69)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1zaeb2, d1zaeb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zaeA (A:)
hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
qkklyrgslk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zaeB (B:)
hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
qkklyrgslk