PDB entry 1zaa

View 1zaa on RCSB PDB site
Description: zinc finger-dna recognition: crystal structure of a zif268-dna complex at 2.1 angstroms
Deposited on 1992-09-17, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zaaC (C:)
rpyacpvescdrrfsrsdeltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
facdicgrkfarsderkrhtkihlr