PDB entry 1z8m

View 1z8m on RCSB PDB site
Description: Solution structure of the conserved hypothtical protein HP0894 from Helicobacter pylori
Class: Structural genomics, Unknown function
Keywords: Structural genomics, HP0894, hypothetical protein, Helicobacter pylori, Unknown function
Deposited on 2005-03-30, released 2005-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein HP0894
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP0894
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z8ma1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8mA (A:)
    mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
    ikpdvllvylvkddelillrlgshself