PDB entry 1z6m

View 1z6m on RCSB PDB site
Description: Structure of Conserved Protein of Unknown Function from Enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, structural genomics, MCSG, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-03-22, released 2005-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein
  Species: Enterococcus faecalis [TaxId:226185]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q837R1 (3-174)
    • cloning artifact (0-2)
  Domains in SCOPe 2.08: d1z6ma1, d1z6ma2
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z6mA (A:)
  snamdisvidatkvntetglhigesnapvkmiefinvrcpycrkwfeeseellaqsvksg
  kveriiklfdkekeslqrgnvmhhyidysapeqalsalhkmfatqdewgnltleevatya
  eknlglkeqkdatlvsaviaeanaahiqfvptiiigeyifdesvteeelrgyiek