SCOPe 2.08: Domain d1z6ma1: 1z6m A:1-172

Lineage for d1z6ma1 (1z6m A:1-172)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein Hypothetical protein EF0770 [142359] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [142360] (1 PDB entry)
   Uniprot Q837R1 1-172

8. Domain d1z6ma1: 1z6m A:1-172 [124529]
   Other proteins in same PDB: d1z6ma2
   complexed with po4

Details for d1z6ma1

PDB Entry: 1z6m, 1.3 Å

PDB Description: structure of conserved protein of unknown function from enterococcus faecalis v583

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1z6ma1:

Sequence; same for both SEQRES and ATOM records:

>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]}
mdisvidatkvntetglhigesnapvkmiefinvrcpycrkwfeeseellaqsvksgkve
riiklfdkekeslqrgnvmhhyidysapeqalsalhkmfatqdewgnltleevatyaekn
lglkeqkdatlvsaviaeanaahiqfvptiiigeyifdesvteeelrgyiek

Timeline for d1z6ma1:

• d1z6ma1 first appeared in SCOP 1.73
  
• d1z6ma1 appears in SCOPe 2.07