Lineage for d1z6ma1 (1z6m A:1-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878764Protein Hypothetical protein EF0770 [142359] (1 species)
  7. 2878765Species Enterococcus faecalis [TaxId:1351] [142360] (1 PDB entry)
    Uniprot Q837R1 1-172
  8. 2878766Domain d1z6ma1: 1z6m A:1-172 [124529]
    Other proteins in same PDB: d1z6ma2
    complexed with po4

Details for d1z6ma1

PDB Entry: 1z6m (more details), 1.3 Å

PDB Description: structure of conserved protein of unknown function from enterococcus faecalis v583
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1z6ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]}
mdisvidatkvntetglhigesnapvkmiefinvrcpycrkwfeeseellaqsvksgkve
riiklfdkekeslqrgnvmhhyidysapeqalsalhkmfatqdewgnltleevatyaekn
lglkeqkdatlvsaviaeanaahiqfvptiiigeyifdesvteeelrgyiek

SCOPe Domain Coordinates for d1z6ma1:

Click to download the PDB-style file with coordinates for d1z6ma1.
(The format of our PDB-style files is described here.)

Timeline for d1z6ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z6ma2