PDB entry 1z33

View 1z33 on RCSB PDB site
Description: Crystal structure of Trichomonas vaginalis purine nucleoside phosphorylase
Class: transferase
Keywords: alpha-beta-alpha sandwich, TRANSFERASE
Deposited on 2005-03-10, released 2005-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z33 (0-234)
    Domains in SCOPe 2.06: d1z33a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z33A (A:)
    atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm
    ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf
    mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem
    esaglfpiadlygaragcictvsdhilhheettaeerqnsfqnmmkialeaaikl