PDB entry 1yzf

View 1yzf on RCSB PDB site
Description: Crystal structure of the lipase/acylhydrolase from Enterococcus faecalis
Class: hydrolase
Keywords: Enterococcus faecalis, lipase/acylhydrolase, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2005-02-28, released 2005-04-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase/acylhydrolase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: gi:29342277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1yzfa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yzfA (A:)
mrkivlfgdsitagyldeavspvlvdlvkrdiaamgleevavinagmpgdttedglkrln
kevliekpdevviffgandasldrnitvatfrenletmiheigsekvilitppyadsgrr
perpqtrikelvkvaqevgaahnlpvidlykamtvypgtdeflqadglhfsqvgyellga
livreikgrlkpkqa