PDB entry 1ywu

View 1ywu on RCSB PDB site
Description: Solution NMR structure of Pseudomonas Aeruginosa protein PA4608. Northeast Structural Genomics target PaT7
Class: structural genomics, unknown function
Keywords: PA4608, PaT7, beta barrel, PilZ domain, structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein PA4608
  Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
  Gene: PA4608
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HVI1 (22-146)
  Domains in SCOPe 2.07: d1ywua1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ywuA (A:)
  mgsshhhhhhssgrenlyfqghmsdqhderrrfhriafdadseilqgerrwevllhdvsl
  hgilvgqpqdwngdpqrpfearlylgldvlirmeislawardgllgfecqhidldsishl
  rrlvelnlgdeellerelallvsahddgs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ywuA (A:)
  msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear
  lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv
  sahdd