PDB entry 1yvc

View 1yvc on RCSB PDB site
Description: Solution structure of the conserved protein from the gene locus MMP0076 of Methanococcus maripaludis. Northeast Structural Genomics target MrR5.
Class: structural genomics, unknown function
Keywords: MrR5, NMR Structure, AutoStructure, AutoAssign, Northeast Structural Genomics, AutoQF, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-02-15, released 2005-04-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MrR5
  Species: Methanococcus maripaludis [TaxId:39152]
  Gene: Locus MMP0076
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6M142 (0-68)
  Domains in SCOPe 2.05: d1yvca1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yvcA (A:)
  mafgkpamknvpveagkeyevtiedmgkggdgiaridgfvvfvpnaekgsvinvkvtavk
  ekfafaervl