Lineage for d1yvca1 (1yvc A:1-69)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789696Family b.40.4.12: TRAM domain [101768] (3 proteins)
    Pfam PF01938
  6. 1789700Protein Hypothetical protein MMP0076 [141313] (1 species)
  7. 1789701Species Methanococcus maripaludis [TaxId:39152] [141314] (1 PDB entry)
    Uniprot Q6M142 1-69
  8. 1789702Domain d1yvca1: 1yvc A:1-69 [124094]

Details for d1yvca1

PDB Entry: 1yvc (more details)

PDB Description: solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5.
PDB Compounds: (A:) MrR5

SCOPe Domain Sequences for d1yvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvca1 b.40.4.12 (A:1-69) Hypothetical protein MMP0076 {Methanococcus maripaludis [TaxId: 39152]}
mafgkpamknvpveagkeyevtiedmgkggdgiaridgfvvfvpnaekgsvinvkvtavk
ekfafaerv

SCOPe Domain Coordinates for d1yvca1:

Click to download the PDB-style file with coordinates for d1yvca1.
(The format of our PDB-style files is described here.)

Timeline for d1yvca1: